DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.7 and Ndufa11

DIOPT Version :9

Sequence 1:NP_611538.1 Gene:ND-B14.7 / 37385 FlyBaseID:FBgn0034576 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_081520.1 Gene:Ndufa11 / 69875 MGIID:1917125 Length:143 Species:Mus musculus


Alignment Length:133 Identity:42/133 - (31%)
Similarity:60/133 - (45%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYDHPDGEDAFGKIVATNKYAVSAGVAWSMFDVLTLSKPQGYLPTLGRFAYNTGPLMGMATAFTL 72
            |::.|||.....|...|.......|:..|.:.| :|:.....|..:.|....|.....:...|.|
Mouse    11 YHEVPDGTQCHRKTYITTALGGICGIIGSAYSV-SLNPADSTLEAVARVGRYTFTAAAIGAMFGL 74

  Fly    73 TTLVATNARGK-DDKINYLIGGFAAGGVFGAWKHNHVAGLCAGLFLGIAGVIKKMSIEQGWEFFP 136
            ||.|:...|.| ||.:||.|||.|.|...||..|::.......:::|.|..:.|:...:|||.||
Mouse    75 TTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAMGCVYMGTAAALFKIGKLEGWELFP 139

  Fly   137 NTP 139
             ||
Mouse   140 -TP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.7NP_611538.1 None
Ndufa11NP_081520.1 Tim17 20..124 CDD:396842 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834492
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DS1J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5366
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456214at2759
OrthoFinder 1 1.000 - - FOG0007102
OrthoInspector 1 1.000 - - oto94765
orthoMCL 1 0.900 - - OOG6_106922
Panther 1 1.100 - - LDO PTHR21382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10757
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.