DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.7 and NDUFA11

DIOPT Version :9

Sequence 1:NP_611538.1 Gene:ND-B14.7 / 37385 FlyBaseID:FBgn0034576 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001180304.1 Gene:NDUFA11 / 126328 HGNCID:20371 Length:228 Species:Homo sapiens


Alignment Length:141 Identity:43/141 - (30%)
Similarity:63/141 - (44%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYYDHPDGEDAFGKIVATNKYAVSAGVAWSMFDVLTLSKPQGYLPTLGRFAYNTGPLMGMATAFT 71
            :|:|.|||.|...|..:|...|..||:..:.:.| ||:.|..:|..:.:....|.....:...|.
Human     8 QYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRV-TLNPPGTFLEGVAKVGQYTFTAAAVGAVFG 71

  Fly    72 LTTLVATNARGK-DDKINYLIGGFAAGGVFGAWKHNHVAGLCAGLFLGIAGVIKKMSIEQGWEFF 135
            |||.::.:.|.| ||.:||.:||.|.|...||.|......:.|||.|     :...|        
Human    72 LTTCISAHVREKPDDPLNYFLGGCAGGLTLGARKTGSHCVVQAGLKL-----LASSS-------- 123

  Fly   136 PNTPIKQYGGL 146
            |:|...|..|:
Human   124 PHTSASQSAGI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.7NP_611538.1 None
NDUFA11NP_001180304.1 Tim17 <62..116 CDD:280604 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144353
Domainoid 1 1.000 79 1.000 Domainoid score I8774
eggNOG 1 0.900 - - E1_2DS1J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5238
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456214at2759
OrthoFinder 1 1.000 - - FOG0007102
OrthoInspector 1 1.000 - - oto91182
orthoMCL 1 0.900 - - OOG6_106922
Panther 1 1.100 - - LDO PTHR21382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10757
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.