Sequence 1: | NP_001369100.1 | Gene: | CG10543 / 37379 | FlyBaseID: | FBgn0034570 | Length: | 1666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128556.1 | Gene: | Zfp322a / 680201 | RGDID: | 1594230 | Length: | 399 | Species: | Rattus norvegicus |
Alignment Length: | 257 | Identity: | 71/257 - (27%) |
---|---|---|---|
Similarity: | 109/257 - (42%) | Gaps: | 40/257 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 721 DKPSYNCLLCPKSYRKRKSLLDHYKMH----PGYCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVC 781
Fly 782 ETCGESYSRKQQFHAHVESHNKKEIKTFPCGECGLKFPQKKLQQHFEETGHKADGAICEVCGEEF 846
Fly 847 QSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALK 911
Fly 912 EHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTFKWKTHLVRHKQT 973 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10543 | NP_001369100.1 | C2H2 Zn finger | 727..747 | CDD:275368 | 5/19 (26%) |
C2H2 Zn finger | 751..773 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 781..801 | CDD:275368 | 4/19 (21%) | ||
PHA00733 | <804..860 | CDD:177301 | 9/55 (16%) | ||
C2H2 Zn finger | 811..827 | CDD:275368 | 0/15 (0%) | ||
C2H2 Zn finger | 839..860 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 868..888 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 897..913 | CDD:275368 | 5/15 (33%) | ||
C2H2 Zn finger | 926..946 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 954..975 | CDD:275368 | 7/20 (35%) | ||
Zfp322a | NP_001128556.1 | COG5048 | <68..218 | CDD:227381 | 48/184 (26%) |
C2H2 Zn finger | 72..92 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 100..120 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 128..148 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 140..165 | CDD:290200 | 9/54 (17%) | ||
C2H2 Zn finger | 156..176 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 168..192 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 294..314 | CDD:275368 | |||
C2H2 Zn finger | 322..344 | CDD:275368 | |||
C2H2 Zn finger | 352..372 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |