DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and CG1024

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:466 Identity:88/466 - (18%)
Similarity:141/466 - (30%) Gaps:196/466 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 HQRQMMMMPEDFPQHGASMMNSRQMPALAA--LSNLGDTPAMS--GQLNSSLELDDNDLSADE-D 668
            |.|::    |.:......|...:..|..||  ..|.....|:.  |:...|.....|||.... .
  Fly   127 HMREI----EKYENKLRQMKRQQAKPTTAAAPAGNAEKPMAVKPRGRPKGSTNRKQNDLLQKALM 187

  Fly   669 DDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGGQTPGSKKDKPSYNCLLCPKS 733
            |.||:.::::             |..|:|.||.::            |....:....|...|..:
  Fly   188 DIDLNTEMEK-------------SPVTALAAPVNE------------PKPISNVSELNLDRCLNA 227

  Fly   734 Y-----RKRKSLLDHYKMHPGYCHDCGQRNGNTLEEIIHHNRTMHVKEF----PFVCETCGESYS 789
            |     ::.|.::..|              .:.|:.:        .|||    |...:  ||:..
  Fly   228 YEDIVRKEEKEVVPKY--------------DDELDAL--------CKEFFDDGPSAGK--GEANE 268

  Fly   790 RKQQFHAHVESHN-------------------KKEIKTFPCGECGLKFPQKKLQ-----QHFEET 830
            .:||..||::..|                   |||:|:.|..:     |.|:.:     ....:|
  Fly   269 EQQQDDAHLQQGNQEVVIIEIDALGKEEVAQLKKEMKSDPISQ-----PTKRRRISTTPSRDSDT 328

  Fly   831 GHKADGA------ICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRF-------------- 875
            ....:|.      :|..||:|..|.:....|:.:.|.    || ||..|.|              
  Fly   329 EMSTNGLTKLISYLCPKCGKEIASMDGWRAHVFKKHD----FE-HIIENSFKILESGRKAMCLQC 388

  Fly   876 ------TLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALKEHYSNAHVDVSECKCTLCGKRFG 934
                  |:::.|::|...|.    ||      .||.                   |||||.:...
  Fly   389 REVQPTTVRSQLQKHCFKHL----PY------RSYL-------------------KCTLCDRTKT 424

  Fly   935 SAKSLQRHLP-SHSEE-----------RPH----------------------------CCNYCDQ 959
            |...:..|:. :|.||           :|.                            .|.:||:
  Fly   425 STSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQAVCEHCDR 489

  Fly   960 TFKWKTHLVRH 970
            .|:.|....||
  Fly   490 VFRSKWRYERH 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 4/24 (17%)
C2H2 Zn finger 751..773 CDD:275368 1/21 (5%)
C2H2 Zn finger 781..801 CDD:275368 6/19 (32%)
PHA00733 <804..860 CDD:177301 14/66 (21%)
C2H2 Zn finger 811..827 CDD:275368 2/20 (10%)
C2H2 Zn finger 839..860 CDD:275368 6/20 (30%)
C2H2 Zn finger 868..888 CDD:275368 7/39 (18%)
C2H2 Zn finger 897..913 CDD:275368 2/15 (13%)
C2H2 Zn finger 926..946 CDD:275368 6/20 (30%)
C2H2 Zn finger 954..975 CDD:275368 7/17 (41%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.