DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and CG10654

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:269 Identity:73/269 - (27%)
Similarity:108/269 - (40%) Gaps:45/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 LCPKSYRKRKSLLDHYKMHPGYCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCETCGESYSRKQQ 793
            :|.:|.|..:.||....:.   ||        .||:     .|.|..:.|   ....||.:.:.|
  Fly   104 MCAESLRNFEKL
LQDIDIG---CH--------KLED-----HTWHDLDTP---SESNESTNPEAQ 149

  Fly   794 FHAHVESHNKKEIKTF----PCGECGLKFPQKKLQQHFEETGHK-ADGAICEVCGEEFQSKNALY 853
            .||...:.. :||.:|    .|....:...:..|....||..:. .|.:..:..|:|   |.::.
  Fly   150 SHAPCIAAT-QEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQE---KLSIS 210

  Fly   854 QHIIRVHKR---DNFFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALKEHYS 915
            ..::...||   .:..||.|||..|...:.||.|:|.| |..|||.|..|..||.....|:.|..
  Fly   211 SKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQH-EGLRPYTCVHCAKSYARANLLESHLR 274

  Fly   916 NAHVDVSECK----CTLCGKRFGSAKSLQRHLPS-----HSEERP---HCCNYCDQTFKWKTHLV 968
            ..|.:....:    |..|.|.:.:.:||:.|:..     |..|.|   |.|..|.:.|..|.||.
  Fly   275 QMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLT 339

  Fly   969 RHKQTMHGN 977
            |||. :||:
  Fly   340 RHKM-VHGS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 5/17 (29%)
C2H2 Zn finger 751..773 CDD:275368 5/21 (24%)
C2H2 Zn finger 781..801 CDD:275368 5/19 (26%)
PHA00733 <804..860 CDD:177301 11/60 (18%)
C2H2 Zn finger 811..827 CDD:275368 2/15 (13%)
C2H2 Zn finger 839..860 CDD:275368 3/20 (15%)
C2H2 Zn finger 868..888 CDD:275368 9/19 (47%)
C2H2 Zn finger 897..913 CDD:275368 5/15 (33%)
C2H2 Zn finger 926..946 CDD:275368 6/24 (25%)
C2H2 Zn finger 954..975 CDD:275368 9/20 (45%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 3/10 (30%)
C2H2 Zn finger 228..248 CDD:275368 9/19 (47%)
C2H2 Zn finger 256..313 CDD:275368 13/56 (23%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 10/22 (45%)
C2H2 Zn finger 325..345 CDD:275368 9/20 (45%)
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.