DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and Plzf

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:569 Identity:112/569 - (19%)
Similarity:188/569 - (33%) Gaps:192/569 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 SLHRPQLTPQAQNQLAASMKPSDHIPISMPMENMDLKAGQAAHGTANAIMQGGSSSLASQLHQQQ 579
            :||:| |..:..|.|....:......:.:.:::.| ....:.|   ..::...|..:.|...|||
  Fly    12 TLHQP-LHSKVSNYLNNQRRTGQFCDLLLELDSDD-SLSLSVH---FCVLAAQSQFINSNQKQQQ 71

  Fly   580 KPYNSSNNPLSMMGGMMQQQQQQHVAMPHHQRQMMMMPEDFPQHGASMMNSRQMPALAALSNLGD 644
               .|.:|||.:........|..|..:......::.:.::...|...:   .|:.|:..|.||  
  Fly    72 ---FSIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFREL---AQILAVTELLNL-- 128

  Fly   645 TPAMSGQLNSSLELDDNDLSADEDDDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSG 709
                                         :.|..|..||:         :|.:.||         
  Fly   129 -----------------------------YQLQPLGEAKE---------ATEIPAP--------- 146

  Fly   710 GSGGQTPGSKK-------DKPSY----------------NCLLCP-KSYRKRKSL---------- 740
            |.....|..:|       ::.||                .|:.|. |.|:.:|.:          
  Fly   147 GEAQPNPDPEKKAEAVFENRQSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSH 211

  Fly   741 ----------LD------HYKMHPG------YCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCET 783
                      ||      |.:.|.|      :|..||.|.......::|..:  |..|.|.:|..
  Fly   212 LICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPK--HSTETPHICPH 274

  Fly   784 CGESYSRKQQFHAHVESHNKKEIKTFPCGECGLKFPQKKLQQHFEETGHKADGAICEVCGEEFQS 848
            ||:.:..||....|:..||                |:|::              :|:|||.....
  Fly   275 CGKGFKWKQGLSNHILVHN----------------PEKQM--------------LCDVCGYSTTH 309

  Fly   849 KNALYQHIIRVHKRDNFFECHI--CHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALK 911
            ..||..|.: :|..: ||.|.:  |.:|...|.||:.|::.|.: .|.::|::||          
  Fly   310 MKALKSHKL-LHTGE-FFACTVSGCKHRANRKENLKLHIETHKQ-GRDFICEVCG---------- 361

  Fly   912 EHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERP--HCCNYCDQTFKWKTHLVRHKQTM 974
                        ||       |..:|:|:||...|:|..|  :.|..|..:......:..|.|.:
  Fly   362 ------------CK-------FSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRV 407

  Fly   975 HGNEPPPPKKGKQRFPKTSEEDMGSLPDMPGPPPVKASKKAATSKAKAQ 1023
            |..:|..        .:.||....|.||....|.::.|.|......|::
  Fly   408 HTEKPVQ--------LELSETVDSSFPDDFELPVIETSPKKKPKSVKSK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 8/46 (17%)
C2H2 Zn finger 751..773 CDD:275368 5/21 (24%)
C2H2 Zn finger 781..801 CDD:275368 6/19 (32%)
PHA00733 <804..860 CDD:177301 9/55 (16%)
C2H2 Zn finger 811..827 CDD:275368 2/15 (13%)
C2H2 Zn finger 839..860 CDD:275368 7/20 (35%)
C2H2 Zn finger 868..888 CDD:275368 7/21 (33%)
C2H2 Zn finger 897..913 CDD:275368 3/15 (20%)
C2H2 Zn finger 926..946 CDD:275368 5/19 (26%)
C2H2 Zn finger 954..975 CDD:275368 4/20 (20%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 60/273 (22%)
C2H2 Zn finger 214..234 CDD:275368 3/19 (16%)
C2H2 Zn finger 244..264 CDD:275368 5/21 (24%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
C2H2 Zn finger 330..349 CDD:275368 6/18 (33%)
C2H2 Zn finger 357..377 CDD:275368 10/48 (21%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.