DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and Opbp

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:429 Identity:94/429 - (21%)
Similarity:166/429 - (38%) Gaps:87/429 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 SGQLNSSLELDDNDLSADEDDDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGG 713
            ||:|:...|:.::.:|.:..::|:.:    .|....:|::         :.|.:......     
  Fly    61 SGELDFIEEVAEDCISEEVGEEDIVY----ADVPLWELVE---------EVPANVKAEKD----- 107

  Fly   714 QTPGSKKDKPSYNCLLCPKSYRKRKSLLDHY--KMHPGYCHDCGQRNGNTLEEIIHHNRTMHVKE 776
            |...|..|:  |.|..|...:..|....:|.  :...|   ...|::|:....:.....::..:.
  Fly   108 QNEPSNSDR--YFCYDCHSIFENRNKAEEHICPRAESG---GSSQQDGDAKAPVRRKLASVSART 167

  Fly   777 FP------FVCETCGESYSRKQQFHAHVESHNKK------------------EIKTFPCGECGLK 817
            .|      ..|..|...:|.::....|:..|..:                  |:..|.|..|...
  Fly   168 GPRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKS 232

  Fly   818 FPQKKLQQHFEETGHKADGAICEVCGEEFQSKNALYQHIIRVHK--RDN---------------- 864
            |.:..|..|.:....::...:|.:|..:|::: ..||...::|:  ||:                
  Fly   233 FDETLLTVHKQMHQQESSEIMCSICNRKFENE-VTYQMHQKIHEKPRDSESSRKLAQRTSLDKEK 296

  Fly   865 -FFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALKEHYSNAHVDVSECKCTL 928
             .|.|..|...||......:|.::||. ::||.|::||.::....:|..|. ..|.::....||:
  Fly   297 PGFPCQYCERVFTRPFEKVKHERVHTG-EKPYACEVCGKTFRVSYSLTLHL-RTHTNIRPYVCTV 359

  Fly   929 CGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTFKWKTHLVRHKQTMHG--------NEPPPPKKG 985
            |.|||.|.:....||..||.||...|:.|.:||:....|..||.| |.        |.|......
  Fly   360 CNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNT-HTKPYRCAVCNRPFSSMYA 423

  Fly   986 KQRFPKTSEE--DMGSLPDMPGPPPVKASKKAATSKAKA 1022
            .:...:|.:|  ..||:..  |.|.:|:   |||||::|
  Fly   424 VKNHMQTHKEISSKGSVGS--GTPNIKS---AATSKSQA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 4/21 (19%)
C2H2 Zn finger 751..773 CDD:275368 2/21 (10%)
C2H2 Zn finger 781..801 CDD:275368 4/19 (21%)
PHA00733 <804..860 CDD:177301 12/73 (16%)
C2H2 Zn finger 811..827 CDD:275368 4/15 (27%)
C2H2 Zn finger 839..860 CDD:275368 5/20 (25%)
C2H2 Zn finger 868..888 CDD:275368 5/19 (26%)
C2H2 Zn finger 897..913 CDD:275368 4/15 (27%)
C2H2 Zn finger 926..946 CDD:275368 9/19 (47%)
C2H2 Zn finger 954..975 CDD:275368 8/20 (40%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/20 (25%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 8/20 (40%)
C2H2 Zn finger 329..349 CDD:275368 5/20 (25%)
zf-H2C2_2 341..366 CDD:290200 9/25 (36%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
C2H2 Zn finger 385..405 CDD:275368 8/20 (40%)
C2H2 Zn finger 411..431 CDD:275368 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.