DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and let-391

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_491744.3 Gene:let-391 / 182953 WormBaseID:WBGene00006492 Length:453 Species:Caenorhabditis elegans


Alignment Length:421 Identity:77/421 - (18%)
Similarity:135/421 - (32%) Gaps:154/421 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 EDDDDLDHDLDEL----------DAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGGQTPGSKKD 721
            ::::|||.:.|.:          ||.|:.     ......::.|.|.:        .:..|::|.
 Worm     2 KNNEDLDENSDAIFEEWAAECTPDAQKEH-----EELEEIVKIPDSTY--------RKKKGNQKL 53

  Fly   722 KPSYNCLLCPKSYRKRKSLLDHYKMHPG----YCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCE 782
            .....|.:|..:.:....:::|.:.|.|    .|..||.| ......:|:|.|..|:.:.||:|.
 Worm    54 PTVTTCEVCGVALKYPSRIMEHMRTHTGEKPYECDICGMR-FTQRTPMINHFRVQHMGDLPFLCN 117

  Fly   783 -TCGESYSRKQQFHAHVESHN-----------KKEIKTFPC------------------------ 811
             .||:.:....:..||..|||           .|.:|...|                        
 Worm   118 FGCGKRFVNNSRRTAHELSHNGLKRAGPARPYLKPVKKIVCPSMDMDILSNSALANYISPPTIDS 182

  Fly   812 ------------------------------------------------------------GECGL 816
                                                                        .|..:
 Worm   183 IFQSDPSTSSSSPSQFQSSNQTTKQSIYPSEKEMEKAAISNARIDDVINTVLARVLAPIDEEIPI 247

  Fly   817 KFPQKKLQQHFEETGHKADGAICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANL 881
            :.|:|..|:....:..:|..|.|.:||...:..:.:..| ||.|..:..|||..|....:..::|
 Worm   248 EEPEKAPQKRAYISNRRATLAQCNICGLMLKHPSKIADH-IRTHTGEKPFECGECGLSLSKASSL 311

  Fly   882 ERHV-QLHTEIKRPYVCD-LCGSSYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLP 944
            :.|: ::||. :||:.|. .||.|:.|....|||....|..:....|.:.|              
 Worm   312 KVHIRRMHTG-ERPFECTWRCGLSFVTDSVRKEHEMTVHTGIKRYTCVVKG-------------- 361

  Fly   945 SHSEERPHCCNYCDQTFKWKTHLVRHKQTMH 975
                        |:..|..:.:|:||::..|
 Worm   362 ------------CNAVFARRVYLMRHRKNAH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 3/19 (16%)
C2H2 Zn finger 751..773 CDD:275368 7/21 (33%)
C2H2 Zn finger 781..801 CDD:275368 5/20 (25%)
PHA00733 <804..860 CDD:177301 15/139 (11%)
C2H2 Zn finger 811..827 CDD:275368 5/99 (5%)
C2H2 Zn finger 839..860 CDD:275368 6/20 (30%)
C2H2 Zn finger 868..888 CDD:275368 4/20 (20%)
C2H2 Zn finger 897..913 CDD:275368 6/16 (38%)
C2H2 Zn finger 926..946 CDD:275368 2/19 (11%)
C2H2 Zn finger 954..975 CDD:275368 5/20 (25%)
let-391NP_491744.3 C2H2 Zn finger 59..79 CDD:275368 3/19 (16%)
zf-H2C2_2 73..96 CDD:290200 7/23 (30%)
C2H2 Zn finger 87..108 CDD:275368 7/21 (33%)
C2H2 Zn finger 116..137 CDD:275368 5/20 (25%)
C2H2 Zn finger 270..290 CDD:275368 6/20 (30%)
zf-H2C2_2 286..304 CDD:290200 8/18 (44%)
C2H2 Zn finger 298..319 CDD:275368 4/20 (20%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
C2H2 Zn finger 357..377 CDD:275368 7/45 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.