DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10543 and szy-5

DIOPT Version :9

Sequence 1:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:szy-5 / 172281 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans


Alignment Length:497 Identity:98/497 - (19%)
Similarity:159/497 - (31%) Gaps:194/497 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 SMPMENMDLKAGQAAHGTANAIMQ-----------------GGSSSLASQLHQQQKPYNSSNNPL 589
            |:|.||:..:..:||.|.:...:|                 ....||..::.      |...|  
 Worm   256 SIPYENLHFEHVEAAPGPSEPHLQVVAEGEILYDGEEIVDISNGKSLKEEIQ------NGDAN-- 312

  Fly   590 SMMGGMMQ--QQQQQHVAMPHHQRQ---MMMMPEDFPQHGASMMNSRQMPALAALSNLGDTPAMS 649
              :.||:|  :::.:.:.....:|:   :|:.|.. |:.|...:........|.:..:.|.    
 Worm   313 --IYGMIQDLEEEVEDIGNEDEERERVRIMVNPNP-PKRGTKSLRDHHEATAATMEMIVDA---- 370

  Fly   650 GQLNSSLELDDNDLSADEDDDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGGQ 714
                |.|||                                        |.||:|     ...|.
 Worm   371 ----SILEL----------------------------------------AEPSRH-----LKQGY 386

  Fly   715 TPGSKKDKPSYNCLLCPKSYRKRKSLLDHYKMHPGYCHDCGQRNGNTLEEIIHHNR--TMHVKEF 777
            .|.||:           |:..||...||       :..|...:..:..|...||.:  |:|    
 Worm   387 PPISKR-----------KNTGKRAENLD-------WIIDAVAKGVDVSEASPHHRKKPTLH---- 429

  Fly   778 PFVCETCGESYSRKQQFHAHVESHNKKEIKTFPCGECGLKFPQK-----KLQQHFEETGHKADGA 837
              .||.||.......:..||:.:|..:  |.|.|..||:.|.||     .|::||::..::    
 Worm   430 --KCEYCGRVDKYPSKIRAHMRTHTGE--KPFKCEICGMAFSQKTPMRLHLRRHFDQKPYE---- 486

  Fly   838 ICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGS 902
             |:|.|                           |..||...|.|:.||:.....|:.|||.    
 Worm   487 -CDVDG---------------------------CKERFVSGAILKMHVEKKHLNKKKYVCS---- 519

  Fly   903 SYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTFKWKTHL 967
                                    ..||:.|.||.: |:|   |.::       |:||:  .|.:
 Worm   520 ------------------------RGCGRVFSSAYN-QKH---HEKK-------CEQTY--VTWV 547

  Fly   968 VRHKQTMHGNEPPPPKKGKQRFPKTSEEDMGSLPDMPGPPPV 1009
            ...:|::...|......|:  :|...||.|..:.|.....|:
 Worm   548 EGEQQSVESGEEDEESNGE--YPDDDEEYMDDMIDASTSQPI 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 5/19 (26%)
C2H2 Zn finger 751..773 CDD:275368 5/23 (22%)
C2H2 Zn finger 781..801 CDD:275368 6/19 (32%)
PHA00733 <804..860 CDD:177301 14/60 (23%)
C2H2 Zn finger 811..827 CDD:275368 7/20 (35%)
C2H2 Zn finger 839..860 CDD:275368 3/20 (15%)
C2H2 Zn finger 868..888 CDD:275368 7/19 (37%)
C2H2 Zn finger 897..913 CDD:275368 1/15 (7%)
C2H2 Zn finger 926..946 CDD:275368 7/19 (37%)
C2H2 Zn finger 954..975 CDD:275368 5/20 (25%)
szy-5NP_491745.2 C2H2 Zn finger 73..93 CDD:275368
C2H2 Zn finger 101..121 CDD:275368
C2H2 Zn finger 129..149 CDD:275368
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 445..468 CDD:372612 9/24 (38%)
C2H2 Zn finger 459..479 CDD:275368 7/19 (37%)
C2H2 Zn finger 487..506 CDD:275368 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.