DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PRE2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:42/174 - (24%)
Similarity:80/174 - (45%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ISHAGTCLGILAEDGILLAAECRST--NKLLDSAIPSEKIYRLNDNMVCSVAGITSDANV----L 86
            |:|..|.|....:.||::|.:.|:|  |.:....:  :|:..:|..::.::||..:|...    |
Yeast    72 IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTV--KKVIEINPFLLGTMAGGAADCQFWETWL 134

  Fly    87 TSELRL--IAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL--LYMGWDNKYGYQL 147
            .|:.||  :.::.:.|   |....:::|:|     .| ||.|.   |:|:  :..|:..|.|..:
Yeast   135 GSQCRLHELREKERIS---VAAASKILSNL-----VY-QYKGA---GLSMGTMICGYTRKEGPTI 187

  Fly   148 YQSDPSGNYGGWKATCIGNN----FGAAISMLKQELADKENVKL 187
            |..|..|........|:|:.    :|...|..|.:|:.::.:.|
Yeast   188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 42/174 (24%)
proteasome_alpha_type_4 3..219 CDD:239721 42/174 (24%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.