DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PRE10

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_015007.1 Gene:PRE10 / 854544 SGDID:S000005889 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:78/254 - (30%)
Similarity:127/254 - (50%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSE--KIYR 67
            ||...::|||:||.:|||||::|:.:..|.:||...||::.|.|...|:|||   :|.:  ||..
Yeast     8 YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLL---VPQKNVKIQV 69

  Fly    68 LNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGV 132
            ::.::.|..:|:..|...|.:..|..|..::..|...||.......|....||:|.|...|||||
Yeast    70 VDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGV 134

  Fly   133 SLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAI 197
            |.::.|.| |.|..||..:|||:|.|:|....|....:|.:.| ::|.|.....|:..:|...|.
Yeast   135 STIFGGVD-KNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAEL-EKLVDHHPEGLSAREAVKQAA 197

  Fly   198 KVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKE 256
            |::.:..:..|....::|::..         |:.|...:.|.: |...:|...:.|:||
Yeast   198 KIIYLAHEDNKEKDFELEISWC---------SLSETNGLHKFV-KGDLLQEAIDFAQKE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 74/241 (31%)
proteasome_alpha_type_4 3..219 CDD:239721 70/215 (33%)
PRE10NP_015007.1 proteasome_alpha_type_3 5..219 CDD:239720 70/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.