DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PUP2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:86/261 - (32%)
Similarity:142/261 - (54%) Gaps:19/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLN 69
            ||...:.|||||||:||||::|||....|.:||..::|::|..|.|:|:.||:|. ..|||..::
Yeast     8 YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEKIVEID 71

  Fly    70 DNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGG------KR 128
            .::.|:::|:|:||..:....|..|..:...|.|.|..|.|...:||:...:.:...      .|
Yeast    72 RHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSR 136

  Fly   129 PFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAK 193
            ||||:||..|.|...||||:.::|||.:..:.|..||:....|    :.||.::.:..|||.:|:
Yeast   137 PFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGA----QAELLNEWHSSLTLKEAE 197

  Fly   194 DLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKEKQ 258
            .|.:|:|...:: .||.....:::.:.:.|...:|      |.||..|...::: |.|||:..::
Yeast   198 LLVLKILKQVME-EKLDENNAQLSCITKQDGFKIY------DNEKTAELIKELK-EKEAAESPEE 254

  Fly   259 A 259
            |
Yeast   255 A 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 81/245 (33%)
proteasome_alpha_type_4 3..219 CDD:239721 75/219 (34%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.