DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PAF2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:251 Identity:84/251 - (33%)
Similarity:139/251 - (55%) Gaps:11/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            :||:..|.:||.|||:||||||||:......:|:.:...::||...::.::|   :....||:::
plant     5 QYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSEL---SSHQRKIFKV 66

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            :|::..::||:|:|..||:..:|..:..:.|:|...:|..:||.||.|..|..||...|||:||.
plant    67 DDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVG 131

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELAD-KENVKLTLADAKDLAI 197
            ||..|.|.. |..||.:.|||||..::|..||:...||.:.|:::... :|:.|..|  .|| ||
plant   132 LLVGGLDES-GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDL--IKD-AI 192

  Fly   198 KVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAA 253
            ..:..||....|   |..:.|:..:.....:..|::..::|:|:.:.||..|.|.|
plant   193 MAIRETLQGETL---KSSLCTVSVLGVDEPFHFLDQESIQKVIDTFEKVPEEEEDA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 79/241 (33%)
proteasome_alpha_type_4 3..219 CDD:239721 75/215 (35%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 76/218 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.