DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PAB1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001031057.1 Gene:PAB1 / 838217 AraportID:AT1G16470 Length:235 Species:Arabidopsis thaliana


Alignment Length:248 Identity:86/248 - (34%)
Similarity:132/248 - (53%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            :|....|.|||.|:|.|:|:|:.|:....|.|||.|.:|:::|.|.:..:.|:|.| ..:||..|
plant     5 QYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEA-SVQKIQHL 68

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            ..|:....:|:..|..||..:.|..|::|...|.|.||..|||.....:.|.:||.||.||||||
plant    69 TPNIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVS 133

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            ||..|:|:| |.||||.||||:|..|||:.:|.|...|.:.|::...:    .:.|.||...||.
plant   134 LLVAGYDDK-GPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE----DMELDDAIHTAIL 193

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAE 251
            .|....: .:::.:.:|:.   ::....|:.||...:::..:       ||.|
plant   194 TLKEGFE-GEISSKNIEIG---KIGADKVFRVLTPAEIDDYL-------AEVE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 83/240 (35%)
proteasome_alpha_type_4 3..219 CDD:239721 80/214 (37%)
PAB1NP_001031057.1 proteasome_alpha_type_2 6..232 CDD:239719 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.