DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PAA1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_198409.1 Gene:PAA1 / 833524 AraportID:AT5G35590 Length:246 Species:Arabidopsis thaliana


Alignment Length:236 Identity:79/236 - (33%)
Similarity:128/236 - (54%) Gaps:9/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAG-TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            ||...|||||||||:|||||.:|:..|| |.:|:..:|.:.:..:.:..:||||.:..:. ::.:
plant     9 YDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLLDQSSVTH-LFPI 72

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            ...:.....|||:||..|..:.|..|..::|:||..:|.:.|...:.|..|.|||:...||.||.
plant    73 TKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADKSQVYTQHAYMRPLGVV 137

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            .:.||.|.:.|..||:.||:|::.|.|||..|.....|::.|::::  |||...|..:....||.
plant   138 AMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKM--KENPSFTFDETVQTAIS 200

  Fly   199 VLSMTL-DTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEK 238
            .|...| :..|.|  ::|:..: |.:|.. :..|...::|:
plant   201 ALQSVLQEDFKAT--EIEVGVV-RAENPE-FRALTTEEIEE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 79/236 (33%)
proteasome_alpha_type_4 3..219 CDD:239721 75/215 (35%)
PAA1NP_198409.1 proteasome_alpha_type_6 8..220 CDD:239723 75/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.