DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PAD1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:259 Identity:90/259 - (34%)
Similarity:146/259 - (56%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            |||...|:|||:|.|:|||||:||:......:|:...|.::||.|.:||.||.||. .:.||..|
plant     3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR-SARKIVSL 66

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            ::::..:.||:.:||.||.::.|:..|.::.:..:.:..|.:..::..::|.|||.||.||||:|
plant    67 DNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLS 131

  Fly   134 LLYMGWDNKYGY----QLYQSDPSGNYGGWKATCIGNNFGAAISMLK---QELADKENVKLTLAD 191
            .|.:|:|   .|    .|||:||||.:..|||...|.|..:....|:   :|.|.:|.||     
plant   132 TLIVGFD---PYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQETVK----- 188

  Fly   192 AKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKK 255
               |||:.|   |:..:...:.:|:|.:.|.:.  |...||:.:::.::.:....:|.||||||
plant   189 ---LAIRAL---LEVVESGGKNIEVAVMTREEG--VLKQLEEEEIDIIVAEIEAEKAAAEAAKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 83/247 (34%)
proteasome_alpha_type_4 3..219 CDD:239721 79/221 (36%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 78/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.