DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma8

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001157081.1 Gene:Psma8 / 73677 MGIID:1920927 Length:250 Species:Mus musculus


Alignment Length:263 Identity:90/263 - (34%)
Similarity:141/263 - (53%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKI 65
            ||.|||...|:|||:|.|:|||||.||:....|.:||...:.::|..|.:|..||.|.. ...||
Mouse     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDER-TVRKI 64

  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130
            ..|:|::..:.||:|:||.|:.|..|:..|.::.:..:.:..|.:...:..:||.|||..|:|||
Mouse    65 CALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPF 129

  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELA------DKENVKLTL 189
            |:|.|.:|:|:....:|||:||||.|..|||..||.:.......|::...      |||.:|   
Mouse   130 GISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDKEAIK--- 191

  Fly   190 ADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAK 254
                 ||||.|   |:..:...:.:|:|.::|.....::|..|   :|..:.:..:.:.|||..|
Mouse   192 -----LAIKAL---LEVVQSGGKNIELAIIRRDQPLKMFSAKE---IELEVSEIEREKDEAEKTK 245

  Fly   255 KEK 257
            .:|
Mouse   246 SKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 85/249 (34%)
proteasome_alpha_type_4 3..219 CDD:239721 79/221 (36%)
Psma8NP_001157081.1 PRK03996 5..235 CDD:235192 82/244 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 78/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.