DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psmb13a

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:203 Identity:50/203 - (24%)
Similarity:87/203 - (42%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSE---KIYRLNDNMVCSVAGITSDANVLT 87
            :|:....|..|::.:||::|.|:.|:|:   |..:..:   ||:.:..|:.|..||..:|....|
Zfish    39 KALKTGTTIAGVVFKDGVVLGADTRATS---DEVVADKMCAKIHYIAPNIYCCGAGTAADTEKTT 100

  Fly    88 SELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDP 152
            ..|......:..:.|.   ..::|..:..|:....:|.|.  .|.:|:..|.|.. |..||...|
Zfish   101 DMLSSNLTIFSMNSGR---NPRVVMAVNIIQDMLFRYHGM--IGANLILGGVDCT-GSHLYTVGP 159

  Fly   153 SGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDL---AIKVLSM-------TLDTT 207
            .|:........:|:...||:.:|:    |:..|.:.|..||.|   ||:...|       .:|..
Zfish   160 YGSMDKVPYLAMGSGDLAAMGILE----DRFKVNMDLEQAKALVSDAIQAGIMCDLGSGNNIDLC 220

  Fly   208 KLTPEKVE 215
            .:|.|.|:
Zfish   221 VITKEGVD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 50/203 (25%)
proteasome_alpha_type_4 3..219 CDD:239721 50/203 (25%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 49/197 (25%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.