Sequence 1: | NP_476691.1 | Gene: | Prosalpha3 / 37378 | FlyBaseID: | FBgn0261394 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571752.2 | Gene: | psmb13a / 64280 | ZFINID: | ZDB-GENE-001208-2 | Length: | 281 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 87/203 - (42%) | Gaps: | 26/203 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 EAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSE---KIYRLNDNMVCSVAGITSDANVLT 87
Fly 88 SELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDP 152
Fly 153 SGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDL---AIKVLSM-------TLDTT 207
Fly 208 KLTPEKVE 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3 | NP_476691.1 | PTZ00246 | 1..245 | CDD:173491 | 50/203 (25%) |
proteasome_alpha_type_4 | 3..219 | CDD:239721 | 50/203 (25%) | ||
psmb13a | NP_571752.2 | proteasome_beta_type_7 | 45..233 | CDD:239732 | 49/197 (25%) |
Pr_beta_C | 241..272 | CDD:315191 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |