DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psmb7

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_021324576.1 Gene:psmb7 / 64278 ZFINID:ZDB-GENE-001208-4 Length:286 Species:Danio rerio


Alignment Length:221 Identity:51/221 - (23%)
Similarity:97/221 - (43%) Gaps:19/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EGRLYQVEYAMEAISHAGTCL-GILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAG 78
            |..:.::.::..|....||.: ||:.:||::|.|:.|:|..::.:.....||:.::.|:.|..||
Zfish    26 EADITKLGFSSPAARKTGTTICGIVYKDGVVLGADTRATEGMIVADKNCSKIHYISPNIYCCGAG 90

  Fly    79 ITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKY 143
            ..:|..:.|..:....:.:..|.|. :|.....:.:  :||...:|.|.  .|.:|:..|.|.. 
Zfish    91 TAADTEMTTQIISSNLELHSLSTGR-LPRVATANRM--LKQMLFRYQGY--IGAALVLGGVDCT- 149

  Fly   144 GYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQEL---ADKENVKLTLADA------KDLAIKV 199
            |..||...|.|:........:|:...||:::.:...   .::|:.|..:.||      .||.   
Zfish   150 GPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDRYRPDMEEEDAKSLVRDAIAAGIFNDLG--- 211

  Fly   200 LSMTLDTTKLTPEKVEMATLQRVDNK 225
            ....:|...:|..||:......:.||
Zfish   212 SGSNIDVCVITKGKVDYLRPHDIANK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 51/221 (23%)
proteasome_alpha_type_4 3..219 CDD:239721 49/213 (23%)
psmb7XP_021324576.1 proteasome_beta_type_7 44..232 CDD:239732 46/196 (23%)
Pr_beta_C 237..280 CDD:315191 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.