DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psmb3

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001123295.1 Gene:psmb3 / 573095 ZFINID:ZDB-GENE-040426-2682 Length:205 Species:Danio rerio


Alignment Length:208 Identity:37/208 - (17%)
Similarity:83/208 - (39%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQ 98
            |:.|.::....:.|:..:|:        .:||:.:.:.:...:||:.:|...::..|:.....|:
Zfish    19 CVAIASDRRFGIQAQLVTTD--------FQKIFPMGERLYIGLAGLATDVQTVSQRLKFRLNLYE 75

  Fly    99 FSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNK-----------YGYQLYQSD- 151
            ...|..|.....:|.:.::  .|.:..|  |:.:..:..|.|.|           .|..:...| 
Zfish    76 LKEGRQIKPRTFMSMVSNL--LYERRFG--PYYIEPVIAGLDPKTFEPFICSLDLIGCPMVTEDF 136

  Fly   152 -PSGNYGGWKATCIGNNFGAAISMLKQELADK---ENVKLTLADAKDL-AIKVLSMTLDTTKLTP 211
             .||       ||....:|...|:.:.::..:   |.:...:.:|.|. |:..:.:.:..  :..
Zfish   137 VVSG-------TCSEQMYGMCESLWEPDMKPEDLFETISQAMLNAVDRDAVSGMGVVVHV--IEK 192

  Fly   212 EKVEMATLQ-RVD 223
            :|:...||: |:|
Zfish   193 DKITTRTLKARMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 37/208 (18%)
proteasome_alpha_type_4 3..219 CDD:239721 33/201 (16%)
psmb3NP_001123295.1 PRE1 3..198 CDD:223711 33/199 (17%)
proteasome_beta_type_3 6..201 CDD:239728 34/202 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.