Sequence 1: | NP_476691.1 | Gene: | Prosalpha3 / 37378 | FlyBaseID: | FBgn0261394 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123295.1 | Gene: | psmb3 / 573095 | ZFINID: | ZDB-GENE-040426-2682 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 37/208 - (17%) |
---|---|---|---|
Similarity: | 83/208 - (39%) | Gaps: | 39/208 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 CLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQ 98
Fly 99 FSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNK-----------YGYQLYQSD- 151
Fly 152 -PSGNYGGWKATCIGNNFGAAISMLKQELADK---ENVKLTLADAKDL-AIKVLSMTLDTTKLTP 211
Fly 212 EKVEMATLQ-RVD 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3 | NP_476691.1 | PTZ00246 | 1..245 | CDD:173491 | 37/208 (18%) |
proteasome_alpha_type_4 | 3..219 | CDD:239721 | 33/201 (16%) | ||
psmb3 | NP_001123295.1 | PRE1 | 3..198 | CDD:223711 | 33/199 (17%) |
proteasome_beta_type_3 | 6..201 | CDD:239728 | 34/202 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |