DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PSMB3

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_002786.2 Gene:PSMB3 / 5691 HGNCID:9540 Length:205 Species:Homo sapiens


Alignment Length:225 Identity:45/225 - (20%)
Similarity:87/225 - (38%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MEAISHAG---------TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGIT 80
            |..:|:.|         .|:.|.|:....:.|:..:|:        .:||:.:.|.:...:||:.
Human     1 MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTD--------FQKIFPMGDRLYIGLAGLA 57

  Fly    81 SDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNK--- 142
            :|...:...|:.....|:...|..|....|:|.:.::  .|.:..|  |:....:..|.|.|   
Human    58 TDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANL--LYEKRFG--PYYTEPVIAGLDPKTFK 118

  Fly   143 --------YGYQLYQSD--PSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAI 197
                    .|..:...|  .||       ||....:|...|:.:..: |.:::..|::.|...|:
Human   119 PFICSLDLIGCPMVTDDFVVSG-------TCAEQMYGMCESLWEPNM-DPDHLFETISQAMLNAV 175

  Fly   198 ---KVLSMTLDTTKLTPEKVEMATLQ-RVD 223
               .|..|.:....:..:|:...||: |:|
Human   176 DRDAVSGMGVIVHIIEKDKITTRTLKARMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 45/225 (20%)
proteasome_alpha_type_4 3..219 CDD:239721 41/218 (19%)
PSMB3NP_002786.2 proteasome_beta_type_3 6..201 CDD:239728 40/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.