Sequence 1: | NP_476691.1 | Gene: | Prosalpha3 / 37378 | FlyBaseID: | FBgn0261394 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002778.1 | Gene: | PSMA2 / 5683 | HGNCID: | 9531 | Length: | 234 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 87/233 - (37%) |
---|---|---|---|
Similarity: | 119/233 - (51%) | Gaps: | 24/233 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MARR-YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEK 64
Fly 65 IYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRP 129
Fly 130 FGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKD 194
Fly 195 LAIKVL------SMTLDT-----------TKLTPEKVE 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3 | NP_476691.1 | PTZ00246 | 1..245 | CDD:173491 | 87/233 (37%) |
proteasome_alpha_type_4 | 3..219 | CDD:239721 | 85/231 (37%) | ||
PSMA2 | NP_002778.1 | proteasome_alpha_type_2 | 6..231 | CDD:239719 | 84/228 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1222564at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |