DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and PSMA1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_683877.1 Gene:PSMA1 / 5682 HGNCID:9530 Length:269 Species:Homo sapiens


Alignment Length:265 Identity:76/265 - (28%)
Similarity:141/265 - (53%) Gaps:15/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            :||:..|::||:||::|:||||||:......:|:.::...:|.|..|:.::|   |...:||..:
Human    11 QYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSEL---AAHQKKILHV 72

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            ::::..|:||:|:||.:|.:.:|......:|.:...:|..:|||.:....|..||..|:||:||.
Human    73 DNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVG 137

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            ||..|:|: .|..::|:.||.||...:|..||....:|.:.|::.::  |.::..|.:.....::
Human   138 LLIAGYDD-MGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMS--EFMECNLNELVKHGLR 199

  Fly   199 VLSMTLDTTK-LTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIE-----KYTKVQAEAEAAKKEK 257
            .|..||...: ||.:.|.:..:.:....|:|   :..||...:|     ...|.|....|.:..:
Human   200 ALRETLPAEQDLTTKNVSIGIVGKDLEFTIY---DDDDVSPFLEGLEERPQRKAQPAQPADEPAE 261

  Fly   258 QAKQP 262
            :|.:|
Human   262 KADEP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 71/246 (29%)
proteasome_alpha_type_4 3..219 CDD:239721 66/215 (31%)
PSMA1NP_683877.1 proteasome_alpha_type_1 12..222 CDD:239718 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.