DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psma3

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011257.1 Gene:psma3 / 496707 XenbaseID:XB-GENE-976787 Length:255 Species:Xenopus tropicalis


Alignment Length:254 Identity:80/254 - (31%)
Similarity:132/254 - (51%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLN 69
            ||...:.|||:||::|||||.:|:.::.|.:||..:||::...|....:||.:.. .:::|:.::
 Frog     8 YDLSASTFSPDGRVFQVEYAAKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEG-SNKRIFNVD 71

  Fly    70 DNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL 134
            .::..:|||:.:||..|....|..|..::.:||..||.:.|...:.....|||.|...||||.|.
 Frog    72 RHVGMAVAGLLADARSLADIAREEASNFRANYGYDIPLKHLSDRVAMYVHAYTLYSAVRPFGCSF 136

  Fly   135 LYMGWDNKYGYQLYQSDPSG-NYGGWKATCIGNNFGAAISMLKQELADKENVKLTLAD------A 192
            :...::...|.|||..|||| :||.|         |.||...|| .|..|..||.:.|      .
 Frog   137 MLGSYNEDDGAQLYMVDPSGISYGYW---------GCAIGKAKQ-AAKTEIEKLQMKDMTCRDVV 191

  Fly   193 KDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAE 251
            |::| |::.:..|..|....::|::.:.::.|.. :.::.| |:.:..|||.|...|.|
 Frog   192 KEVA-KIIYIVHDEVKDKSFELELSWVGKITNGK-HEIVPK-DIREEAEKYAKESLEEE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 77/246 (31%)
proteasome_alpha_type_4 3..219 CDD:239721 71/220 (32%)
psma3NP_001011257.1 proteasome_alpha_type_3 5..217 CDD:239720 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.