DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:212 Identity:37/212 - (17%)
Similarity:83/212 - (39%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRL 92
            :|...|.:.:..:.|:::.|:.|:::....:...::|:.|:.|.:.|..:|..:|...:..   :
  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIAD---I 73

  Fly    93 IAQRYQFSYGE--------VIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQ 149
            :|  |..:|.|        |........:.|        |..:......::..|||.:.|.|:| 
  Fly    74 VA--YSLNYHENQTNKDALVFEAASEFRNYC--------YSYRESLLAGIIVAGWDEQRGGQVY- 127

  Fly   150 SDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIKVLSMTL--DTTKLTPE 212
            |.|.|.....::..||   |:..|.:...:.:.....:.|.|......|.:...:  |.:.....
  Fly   128 SIPLGGMLTRESCTIG---GSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVV 189

  Fly   213 KVEMATLQRVDNKTVYS 229
            ::.:.|...::.:..|:
  Fly   190 RIGIITKDGIERRIFYN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 37/212 (17%)
proteasome_alpha_type_4 3..219 CDD:239721 35/200 (18%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 35/202 (17%)
proteasome_beta_type_6 16..203 CDD:239731 35/203 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.