DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosalpha1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:245 Identity:75/245 - (30%)
Similarity:129/245 - (52%) Gaps:16/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAG-TCLGILAEDGILLAAECRSTNKLLDSAIPS--EKIY 66
            :|...|||||||||||||||.:||:... |.:.:.:.|..::|.:.:.|.|   :.:|.  ..::
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEK---NIVPETVTHLF 70

  Fly    67 RLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFG 131
            |:..::.|::.|..:|:.....:.|..|..:::.||..:|.:.|...:.||.|.|||....||.|
  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135

  Fly   132 VSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLA 196
            .|::.:.:||:.|..:|::||:|.:.|:||..:|.....|.|.|::    |....|:...|..||
  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEK----KYKPNLSEEKAIQLA 196

  Fly   197 IKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKV 246
            |..||..| .....|..:|:..:.:.|  ..:.:|::.::|   |..||:
  Fly   197 ISCLSSVL-AIDFKPNGIEIGVVSKSD--PTFRILDEREIE---EHLTKI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 73/242 (30%)
proteasome_alpha_type_4 3..219 CDD:239721 69/216 (32%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 75/245 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 69/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.