DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:235 Identity:92/235 - (39%)
Similarity:126/235 - (53%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLD--SAIPSEKIY 66
            ||....|.|||.|:|.|:|||:.|:|.....:||:|.:|:::|.|.:..:.|.:  |....|.||
  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69

  Fly    67 RLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFG 131
            . :..||.|  |:..|..:|..:.|.|||.|..:|.|.||..|||..:..:.|.|||.||.||||
  Fly    70 N-HIGMVYS--GMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFG 131

  Fly   132 VSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLA 196
            ||||..||||...| ||||||||.|..||||.:|.|.....:.|::..::    .|.|.||...|
  Fly   132 VSLLICGWDNDRPY-LYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSE----DLELDDAVHTA 191

  Fly   197 IKVLSMTLDTTKLTPEKVEMAT-----LQRVDNKTVYSVL 231
            |..|....: .|:|.:.:|:..     .||:|..::...|
  Fly   192 ILTLKEGFE-GKMTADNIEIGICDQNGFQRLDPASIKDYL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 92/235 (39%)
proteasome_alpha_type_4 3..219 CDD:239721 88/221 (40%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 91/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.