DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psma8

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:263 Identity:89/263 - (33%)
Similarity:148/263 - (56%) Gaps:17/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKI 65
            ||.|||...|:|||:|.|:|||||.||:....|.:||..:|.::|..|.:|..||.:.. ...||
Zfish     1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEER-TVRKI 64

  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130
            ..|::::..:.||:|:||.::.:..|:..|.::.:..:.:..|.:..::..:||.|||..|:|||
Zfish    65 CALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPF 129

  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADK----ENVKLTLAD 191
            |:|.|.:|:|.....:|||:||||.|..|||..||.:.......|::...|:    :|      |
Zfish   130 GISALIVGFDYDGTPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDN------D 188

  Fly   192 AKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKE 256
            |..||||.|   |:..:...:.:|:|.::|  |:.: .:||..::|.|:.:..|.:.|....||:
Zfish   189 AIKLAIKAL---LEVVQSGGKNIELAVIRR--NQPL-KILESKEIETLVAEIEKEKEEEAEKKKQ 247

  Fly   257 KQA 259
            |::
Zfish   248 KKS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 84/247 (34%)
proteasome_alpha_type_4 3..219 CDD:239721 76/219 (35%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 75/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.