DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:253 Identity:49/253 - (19%)
Similarity:95/253 - (37%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIFSPEGRLYQVEYAMEAISHAGT-CLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMV 73
            |...|.|..:..     |.|..|| .|||..:.|::|||:...:...:......|:::::|.|::
  Fly    40 TTMGPYGTKHST-----ASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNIL 99

  Fly    74 CSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCD--------------IKQAYTQY 124
            ...:|..:|   :.|..|.|.|:            .:....||              .:..|.:.
  Fly   100 LGGSGDFAD---IQSIKRNIDQK------------MIEDQCCDDNIEMKPKSLASWMTRVLYNRR 149

  Fly   125 GGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISM-LKQELADKENVKLT 188
            ....|..:.::..|.||:....|...|..|.  .::...:...|...::: |.:|...|:. ..|
  Fly   150 SRMNPLYIDVVVGGVDNEGTPYLANVDLRGR--SYEDYVVATGFARHLAVPLVREKKPKDR-DFT 211

  Fly   189 LADAKDL---AIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKY 243
            ..:|.:|   .::||... ||..::...|.:.::.....:..:.|.|.....:.|:.|
  Fly   212 AVEASELIRTCMEVLYYR-DTRNISQYTVGVCSVNGCGVEGPFQVNENWTFAETIKGY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 49/253 (19%)
proteasome_alpha_type_4 3..219 CDD:239721 45/227 (20%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 38/210 (18%)
PRE1 60..232 CDD:223711 36/190 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.