DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:93/230 - (40%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSV 76
            |||    |:        |:.|:.:.|..:|..::||:.|.::.....:....|:::|:...|...
  Fly    22 FSP----YE--------SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGS 74

  Fly    77 AGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGK-RPFGVSLLYMGWD 140
            ||..:|...||..:::..|.|:.::...:..|.:...|     :...|..: .|:.||.:..|.|
  Fly    75 AGCWADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQML-----SIAMYNRRFFPYYVSNILAGID 134

  Fly   141 NKYGYQLYQSDPSGN-------YGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            |:....:|..||.|:       .||...|.:.......|......|.|.:.:|||    |:.|:.
  Fly   135 NEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLT----KERAVS 195

  Fly   199 VLSMTLDTTK--------------LTPEKVEMATL 219
            |.|.|..:..              :|.:.:|:.||
  Fly   196 VASDTFISAAERDIYTGDSVLINIITKDGIEVRTL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 52/230 (23%)
proteasome_alpha_type_4 3..219 CDD:239721 50/228 (22%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 52/230 (23%)
PRE1 24..225 CDD:223711 47/221 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.