DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psma6

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_989113.1 Gene:psma6 / 394718 XenbaseID:XB-GENE-943786 Length:246 Species:Xenopus tropicalis


Alignment Length:234 Identity:76/234 - (32%)
Similarity:129/234 - (55%) Gaps:7/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAG-TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            :|...|||||||||||||||.:||:..| |.:.:..:|..::..:.:..:|||||...:. ::|:
 Frog     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKLLDSNTVTH-LFRI 72

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            .:::.|.:.|:|:|:.......|..|..:::.||..||.:.|...:.||.|.|||....||.|..
 Frog    73 TESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC 137

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            ::.:|.|.:.|.|:::.||:|.|.|:|||..|.....|.|.|::::  |:.:..|.....:.||.
 Frog   138 MILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKV--KKKLDWTYEQTLETAIS 200

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVE 237
            .||..| :....|.::|:..:...|.|  :.||.:.:::
 Frog   201 CLSTVL-SIDFKPSELEVGVVTVEDPK--FRVLTEAEID 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 76/234 (32%)
proteasome_alpha_type_4 3..219 CDD:239721 72/214 (34%)
psma6NP_989113.1 proteasome_alpha_type_6 8..220 CDD:239723 72/214 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.