DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:128/252 - (50%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPS--EKIYR 67
            ||.....|||||||:|||||:|||....|.:||...:|::||.|.|.|:.|:   :||  |||..
  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLM---VPSTVEKIVE 69

  Fly    68 LNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGE---VIPCEQLVSHLCDIKQAYTQYGG--- 126
            ::.::.|:.:|:.:||..|....|:..|.:.|.|.|   :..|.|.||.|.      .|:|.   
  Fly    70 VDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA------IQFGDSGD 128

  Fly   127 -------KRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKEN 184
                   .|||||::|:.|.:.... ||:..||||.:....|..||:....|    :|.|.|...
  Fly   129 SDGAAAMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGA----QQNLQDLFR 188

  Fly   185 VKLTLADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIE 241
            ..|||.:|.|:::..|...:: .||....||:.|:.:   :..:.:..|.:||:.|:
  Fly   189 PDLTLDEAIDISLNTLKQVME-EKLNSTNVEVMTMTK---EREFYMFTKEEVEQHIK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 84/252 (33%)
proteasome_alpha_type_4 3..219 CDD:239721 79/228 (35%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 84/252 (33%)
proteasome_alpha_type_5 8..222 CDD:239722 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.