DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma8

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:267 Identity:91/267 - (34%)
Similarity:143/267 - (53%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKI 65
            ||.|||...|:|||:|.|:|||||.||:....|.:||...:.::|..|.:|..||.|.. ...||
  Rat     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDER-TVRKI 64

  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130
            ..|:|::..:.||:|:||.|:.|..|:..|.::.:..:.:..|.:...:..:||.|||..|:|||
  Rat    65 CALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPF 129

  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELA------DKENVKLTL 189
            |:|.|.:|:|:....:|||:||||.|..|||..||.:.......|::...      |.|.:|   
  Rat   130 GISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIK--- 191

  Fly   190 ADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIE-KYTKVQAEAEAA 253
                 ||||.|   |:..:...:.:|:|.::|.....::|..|       || :.|:::.|.:.|
  Rat   192 -----LAIKAL---LEVVQSGGKNIELAIIRRDQPLKMFSAKE-------IELEVTEIEREKDEA 241

  Fly   254 KKEKQAK 260
            :|:|..|
  Rat   242 EKKKSKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 85/250 (34%)
proteasome_alpha_type_4 3..219 CDD:239721 78/221 (35%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 83/247 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 77/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.