DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:210 Identity:45/210 - (21%)
Similarity:90/210 - (42%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRY 97
            |.|||...|.::|||:......::.......||::::|:::.|..|.:.|....|..:......|
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly    98 QFSYG-EVIPCEQLVSHLCDIKQAYTQY-GGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWK 160
            :...| ::.|.|.  :|.  .::...:| ..:.|:.|.:...|:|...|.:|...|...|  ...
  Fly    68 KMRNGYDLSPRES--AHF--TRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLAN--ALP 126

  Fly   161 ATCIGNNFGAAISMLKQELADKE-NVKLTLADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDN 224
            ....|:.:||   :....:.|:. :..:|.|:|.|:..|.::           :::...:..:.|
  Fly   127 VNYAGHGYGA---IFASSIYDRYWHPNITQAEAYDVFKKCIA-----------EIQKRLVVNLKN 177

  Fly   225 KTVYSVLEKPDVEKL 239
            .|| :|::|..|..|
  Fly   178 FTV-AVVDKDGVRDL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 45/210 (21%)
proteasome_alpha_type_4 3..219 CDD:239721 38/188 (20%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 45/210 (21%)
proteasome_beta_type_2 1..192 CDD:239727 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.