DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:203 Identity:50/203 - (24%)
Similarity:84/203 - (41%) Gaps:32/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCLGILAEDGILLAAE-CRSTNKL-LDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQ 95
            |.||:...|.|:||:: .|:.:.: ||..:  .|.:|::|..:.|.||...|....:..:.....
  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEV--RKTHRISDYCMMSTAGDGGDCLKFSDFILRNMD 65

  Fly    96 RYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGN----- 155
            .|:.:.|..:.....|..:.....||.:  ....|.||||..|:|...|.:|:..|..||     
  Fly    66 LYKITNGYDLTVRGAVHFIRRHLSAYLK--SDCTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVR 128

  Fly   156 YGGWKA-----TCIGNNF---------------GAAISMLKQELADKENVKLTLADAKDLAIKVL 200
            |||..|     |.|...|               ...|.:.|:.:.:..|:.|.|. :|:...|:.
  Fly   129 YGGHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLI-SKNGITKMN 192

  Fly   201 SMTLDTTK 208
            |:.|::.:
  Fly   193 SINLESLR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 50/203 (25%)
proteasome_alpha_type_4 3..219 CDD:239721 50/203 (25%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 50/203 (25%)
proteasome_beta_type_2 1..193 CDD:239727 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.