DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:139/273 - (50%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKI 65
            |:.|||...|||||:|.|.|||||.||:....|.:|:...:.::|..|.:|..:|.:.. ...||
  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDR-KVRKI 64

  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130
            ..|::::|.:.||:|:||.::.:..::..|.::.:..:.:..|.:...:..:||.|||..|:|||
  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129

  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAI-------SMLKQELADKENVKLT 188
            |:|.|..|:|......|:|::|||.:..:||...|.:  |.:       |..::|:|::..    
  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRS--AKVVREFFEKSYREEEVANEHG---- 188

  Fly   189 LADAKDLAIKVLSMTLDTTKLTPEKVEMA------TLQRVDNKTVYSVLEKPDVEKLIEKYTKVQ 247
               |..|||:.|   |:..:.....:|:|      .|:.:|...:      .|..|:|||     
  Fly   189 ---AVKLAIRAL---LEVAQSGQNNLEVAIMENGKPLKMLDTDVI------TDYVKIIEK----- 236

  Fly   248 AEAEAAKKEKQAK 260
            .:.|..:|:||.|
  Fly   237 EKEEELEKKKQKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 76/256 (30%)
proteasome_alpha_type_4 3..219 CDD:239721 68/228 (30%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 70/244 (29%)
proteasome_alpha_type_7 5..213 CDD:239724 67/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.