DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:236 Identity:55/236 - (23%)
Similarity:102/236 - (43%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDA- 83
            |:::     .|..|.:|.:.:.||:|..:.|:|:..|..:....|:.::|..::.:.||..:|. 
  Fly    65 QIDF-----DHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCT 124

  Fly    84 ---NVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGY 145
               ..||.|.||    ::..|.|.:|.:....::.::...|...|    ..:.::..||..: |.
  Fly   125 YWDRALTRECRL----HELRYKERLPVQSAAKYISNVAAEYKGMG----LCMGMMLAGWSPE-GP 180

  Fly   146 QLYQSDPSGNYGGWKATCIGNNFGAAISML----KQELADKENVKLTLADAKDLA-IKVLSMTLD 205
            .|...|.:|.....|...:|:....|:.:|    :.:|:|.|        |.||| :.|...|: 
  Fly   181 SLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNE--------AYDLAFLAVYHATM- 236

  Fly   206 TTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKV 246
             |.:....|  ..|..:|.....:|..| |.::|.|:|:.|
  Fly   237 -TDIFSGGV--VRLYHMDQGNWRNVANK-DCQELHEQYSGV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 54/233 (23%)
proteasome_alpha_type_4 3..219 CDD:239721 46/207 (22%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 55/236 (23%)
proteasome_beta_type_5 72..259 CDD:239730 46/207 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.