DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:287 Identity:63/287 - (21%)
Similarity:114/287 - (39%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANV--LTS 88
            :||....:.:||:.:||::|.|:.|:|...:.|.....||:.|.|::.|..||..:|..:  ||:
  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107

  Fly    89 ELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPS 153
            ...|...|........:.|..::     :::...:|.|.  .|.:|: ||..:..|.|||...|.
  Fly   108 SAELDLHRLNTERRVPVVCASMM-----LRRTLFRYQGH--IGAALV-MGGVDTTGPQLYCIYPC 164

  Fly   154 GNYGGWKATCIGNNFGAAISMLK-------------------------QELADKENVKLTLADAK 193
            |:........:|:...||:|:|:                         .:|....|:.|.:..||
  Fly   165 GSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAK 229

  Fly   194 DLAIKVLSMTLDTTKLTPEK------------------VEMATLQRVDNKTVYSV-LEKPDVEKL 239
            .      ::.|.|..:..||                  :.:.:||..|.: :|:| .::|..   
  Fly   230 G------AVYLRTDTIASEKGERLGKYGIKPNSTMVTSISVLSLQVTDER-IYAVDDQQPGT--- 284

  Fly   240 IEKYTKVQAEAEAAKKE----KQAKQP 262
                :.||.:::.|.:|    .|.|.|
  Fly   285 ----SGVQLDSQQADEELPEGSQTKSP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 56/264 (21%)
proteasome_alpha_type_4 3..219 CDD:239721 50/237 (21%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 46/206 (22%)
proteasome_beta_type_7 49..236 CDD:239732 45/200 (23%)
Pr_beta_C 241..274 CDD:289249 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.