DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psmb2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:213 Identity:40/213 - (18%)
Similarity:88/213 - (41%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSD----ANVLTSELRLIAQ 95
            :||...|.:|:|::..:.:.::......:|::::::.::....|...|    |..:...::|...
  Rat     5 IGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKM 69

  Fly    96 RYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWK 160
            |..:.............:|.|..::.|      |:.|:||..|:|...|..||..|......  |
  Rat    70 RNGYELSPTAAANFTRRNLADCLRSRT------PYHVNLLLAGYDEHEGPALYYMDYLAALA--K 126

  Fly   161 ATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIKVLSMTLDTTKLTPEKVEMATLQR--VD 223
            |....:.:||.:::   .:.|:   ..|...:::.|:::|...|:            .||:  :.
  Rat   127 APFAAHGYGAFLTL---SILDR---YYTPTISRERAVELLRKCLE------------ELQKRFIL 173

  Fly   224 NKTVYS--VLEKPDVEKL 239
            |...:|  |::|..:..|
  Rat   174 NLPTFSVRVIDKDGIHNL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 40/213 (19%)
proteasome_alpha_type_4 3..219 CDD:239721 33/187 (18%)
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 40/213 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.