DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma7

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001008218.1 Gene:Psma7 / 29674 RGDID:61851 Length:248 Species:Rattus norvegicus


Alignment Length:258 Identity:87/258 - (33%)
Similarity:138/258 - (53%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLN 69
            ||...|:|||:|.|:|||||.||:....|.:|:...|.::|..|.:|..||.|.. ...||..|:
  Rat     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDER-TVRKICALD 66

  Fly    70 DNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL 134
            ||:..:.||:|:||.::.:..|:..|.::.:..:.:..|.:..::..:||.|||..|:||||:|.
  Rat    67 DNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISA 131

  Fly   135 LYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK- 198
            |.:|:|.....:|||:||||.|..|||..||....:....|::...|      ...:..||.|| 
  Rat   132 LIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTD------DAIETDDLTIKL 190

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKY-TKVQAEAEAAKKEKQAK 260
            |:...|:..:...:.:|:|.::|.....:.|..|       |||| .:::.|.|..:|:||.|
  Rat   191 VIKALLEVVQSGGKNIELAVMRRDQPLKILSPEE-------IEKYVAEIEKEKEENEKKKQKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 81/241 (34%)
proteasome_alpha_type_4 3..219 CDD:239721 74/214 (35%)
Psma7NP_001008218.1 PRK03996 1..230 CDD:235192 81/240 (34%)
proteasome_alpha_type_7 3..211 CDD:239724 74/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.