DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma5

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:250 Identity:89/250 - (35%)
Similarity:137/250 - (54%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPS--EKIYR 67
            ||.....|||||||:|||||:|||....|.:||...:|:.||.|.|.|:.|::   ||  |||..
  Rat     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME---PSSIEKIVE 69

  Fly    68 LNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCE---QLVSHLCDIKQAYTQYGGK-- 127
            ::.::.|:::|:.:||..|..:.|:..|.:.|:|.|.:..|   |.||:|.      .|:|.:  
  Rat    70 IDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA------LQFGEEDA 128

  Fly   128 ------RPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVK 186
                  |||||:||:.|.|.| |.||:..||||.:....|..||:....|.|.| ||:..|   .
  Rat   129 DPGAMSRPFGVALLFGGVDEK-GPQLFHMDPSGTFVQCDARAIGSASEGAQSSL-QEVYHK---S 188

  Fly   187 LTLADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIE 241
            :||.:|...::.:|...:: .||....:|:||:|...|   :.:..|.::|::|:
  Rat   189 MTLKEAIKSSLIILKQVME-EKLNATNIELATVQPGQN---FHMFTKEELEEVIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 89/249 (36%)
proteasome_alpha_type_4 3..219 CDD:239721 83/226 (37%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 83/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.