DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma3

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:256 Identity:76/256 - (29%)
Similarity:132/256 - (51%) Gaps:14/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLN 69
            ||...:.|||:||::||||||:|:.::.|.:||..:||::...|....:||.:.. .:::::.::
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEG-SNKRLFNVD 71

  Fly    70 DNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL 134
            .::..:|||:.:||..|....|..|..::.::|..||.:.|...:.....|||.|...||||.|.
  Rat    72 RHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSF 136

  Fly   135 LYMGWDNKYGYQLYQSDPSG-NYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            :...:....|.|||..|||| :||.|     |...|.|....|.|:...:..::|..|......|
  Rat   137 MLGSYSVNDGAQLYMIDPSGVSYGYW-----GCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAK 196

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKEKQA 259
            ::.:..|..|....::|::.:..: .|..:.::.| ||.:..|||.|     |:.|:|.::
  Rat   197 IIYIVHDEVKDKAFELELSWVGEL-TKGRHEIVPK-DVREEAEKYAK-----ESLKEEDES 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 72/240 (30%)
proteasome_alpha_type_4 3..219 CDD:239721 65/214 (30%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 65/214 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.