DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psma2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_058975.1 Gene:Psma2 / 29669 RGDID:61842 Length:234 Species:Rattus norvegicus


Alignment Length:217 Identity:82/217 - (37%)
Similarity:118/217 - (54%) Gaps:8/217 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARR-YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEK 64
            ||.| |....|.|||.|:|.|:|||:.|::.....:||.|.:|::||.|.:..:.|.|.. ...|
  Rat     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER-SVHK 64

  Fly    65 IYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRP 129
            :..:..::....:|:..|..||....|.:||:|...|.|.||..|||..:..:.|.|||.||.||
  Rat    65 VEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRP 129

  Fly   130 FGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKD 194
            ||||||..||:....| |:||||||.|..||||.:|.|:....:.|::    :.|..|.|.||..
  Rat   130 FGVSLLICGWNEGRPY-LFQSDPSGAYFAWKATAMGKNYVNGKTFLEK----RYNEDLELEDAIH 189

  Fly   195 LAIKVLSMTLDTTKLTPEKVEM 216
            .||..|..:.: .::|.:.:|:
  Rat   190 TAILTLKESFE-GQMTEDNIEV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 82/217 (38%)
proteasome_alpha_type_4 3..219 CDD:239721 80/215 (37%)
Psma2NP_058975.1 proteasome_alpha_type_2 6..231 CDD:239719 79/212 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.