DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psmb5

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:179 Identity:44/179 - (24%)
Similarity:83/179 - (46%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIA 94
            |..|.|....:.|:::||:.|:|.....::...:|:..:|..::.::||..:|.:...   ||:|
  Rat    58 HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWE---RLLA 119

  Fly    95 QR---YQFSYGE---VIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL--LYMGWDNKYGYQLYQSD 151
            ::   |:....|   |....:|::::     .| ||.|   .|:|:  :..||| |.|..||..|
  Rat   120 RQCRIYELRNKERISVAAASKLLANM-----VY-QYKG---MGLSMGTMICGWD-KRGPGLYYVD 174

  Fly   152 PSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIKVL 200
            ..||.....|..:|:....|..::.:..    :..|.:.:|.|||.:.:
  Rat   175 SEGNRISGTAFSVGSGSVYAFGVMDRGY----SYDLQVEEAYDLARRAI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 44/179 (25%)
proteasome_alpha_type_4 3..219 CDD:239721 44/179 (25%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 44/179 (25%)
proteasome_beta_type_5 60..247 CDD:239730 43/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.