DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psmb8

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:240 Identity:61/240 - (25%)
Similarity:101/240 - (42%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITS 81
            |..|:|.|     |..|.|....:.|:::|.:.|::.....:.|...|:..:|..::.:::|..:
  Rat    63 RKVQIEMA-----HGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAA 122

  Fly    82 DA----NVLTSELRLIAQRYQFSYGE---VIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL--LYM 137
            |.    .:|..|.||    |....||   |....:|:|::      ..||.|   .|:|:  :..
  Rat   123 DCQYWERLLAKECRL----YYLRNGERISVSAASKLLSNM------MLQYRG---MGLSMGSMIC 174

  Fly   138 GWDNKYGYQLYQSDPSGN--YGGWKATCIGNN--FGAAISMLKQELADKENVKLTLADAKDLAIK 198
            |||.| |..||..|.:|.  .|...:|..||.  :|...|..:|:|:.:|        |.|||.:
  Rat   175 GWDKK-GPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEE--------AYDLARR 230

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKY 243
            .:.........:...|.|..::    |..:..:|..||..|:.||
  Rat   231 AIVYATHRDSYSGGVVNMYHMK----KDGWVKVESTDVSDLLHKY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 61/240 (25%)
proteasome_alpha_type_4 3..219 CDD:239721 54/214 (25%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 59/238 (25%)
proteasome_beta_type_5 73..260 CDD:239730 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.