DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and pas-1

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_506571.1 Gene:pas-1 / 179941 WormBaseID:WBGene00003922 Length:246 Species:Caenorhabditis elegans


Alignment Length:234 Identity:72/234 - (30%)
Similarity:123/234 - (52%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAG-TCLGILAEDGILLAAECRSTNKLLDSAIPSE---KI 65
            :|...||||||||:||||||.:||:... |.:.:...|..::|.:    .::.||.|.::   .:
 Worm     9 FDRHITIFSPEGRVYQVEYAFKAINSTNLTAVAVKGADAAVIAVQ----KRVPDSLIVADTVTSV 69

  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130
            |:::.::.|...|:..||.......:..|..:::..|..:|||.|...:.|:.|.|||....|..
 Worm    70 YQISQSVGCCAIGMIPDAKFQIKRAQGEAASWKYKNGYDMPCELLAKKMADLNQYYTQNAEMRSL 134

  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDL 195
            |.:||::.:|::.|.::|:.||:|.|.|.|...:|.....|.|.|::::  |:..:||..:|.:|
 Worm   135 GCALLFISYDDEKGPEVYRVDPAGYYRGMKGVSVGVKQLPATSFLEKKI--KKKSELTSTEAIEL 197

  Fly   196 AIKVL--SMTLDT-----------------TKLTPEKVE 215
            ||:.|  |:.:|.                 ||||.::||
 Worm   198 AIEALQTSLGIDVRSKDLEVVVVTKDNSKFTKLTSDQVE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 72/234 (31%)
proteasome_alpha_type_4 3..219 CDD:239721 72/234 (31%)
pas-1NP_506571.1 PRE1 7..245 CDD:223711 72/234 (31%)
proteasome_alpha_type_6 8..220 CDD:239723 66/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.