DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and pbs-6

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:232 Identity:54/232 - (23%)
Similarity:94/232 - (40%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVE------YAMEAISHAGTCLGILAEDGILLAAECRST-NKLLDSAIPSEKIYRLNDNMVCSVA 77
            |:|      |:||    .|:...|..|:..::|::.|.| |.:......:|||..||||::.:.:
 Worm    38 QIERQRWNPYSME----GGSTCAISGENFAIVASDTRMTQNDINILTRDAEKIQILNDNIILTTS 98

  Fly    78 GITSDANVLTSELRLIAQRYQFSYG---EVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGW 139
            |...|...|...|:....:|:|.|.   .|..|.:|:|.....::.:..|.|       .:..|.
 Worm    99 GFYGDVLQLKKVLQSRLHKYRFDYRSDMSVDLCAELLSRNLYYRRFFPYYTG-------AILAGI 156

  Fly   140 DNKYGYQLYQSDPSG--NYGGWKAT------------C-IGN------------NFGAAISMLK- 176
            |......::..||.|  ...|:.|:            | ||:            ....|||::| 
 Worm   157 DEHGKGAVFSYDPIGCIERLGYSASGAAEPMIIPFLDCQIGHVTLSEGYERPELTLDRAISLMKD 221

  Fly   177 -------QELADKENVKLTLADA-KDLAIKVLSMTLD 205
                   :|::..:.:.|.:|:| |.:.:|.|.:..|
 Worm   222 SFRGAAEREISTGDKIHLVIAEAGKPVVVKFLPLRED 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 54/232 (23%)
proteasome_alpha_type_4 3..219 CDD:239721 54/232 (23%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 50/218 (23%)
Ntn_hydrolase 44..258 CDD:294319 51/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.