Sequence 1: | NP_476691.1 | Gene: | Prosalpha3 / 37378 | FlyBaseID: | FBgn0261394 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498806.1 | Gene: | pbs-6 / 176161 | WormBaseID: | WBGene00003952 | Length: | 258 | Species: | Caenorhabditis elegans |
Alignment Length: | 232 | Identity: | 54/232 - (23%) |
---|---|---|---|
Similarity: | 94/232 - (40%) | Gaps: | 57/232 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 QVE------YAMEAISHAGTCLGILAEDGILLAAECRST-NKLLDSAIPSEKIYRLNDNMVCSVA 77
Fly 78 GITSDANVLTSELRLIAQRYQFSYG---EVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGW 139
Fly 140 DNKYGYQLYQSDPSG--NYGGWKAT------------C-IGN------------NFGAAISMLK- 176
Fly 177 -------QELADKENVKLTLADA-KDLAIKVLSMTLD 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha3 | NP_476691.1 | PTZ00246 | 1..245 | CDD:173491 | 54/232 (23%) |
proteasome_alpha_type_4 | 3..219 | CDD:239721 | 54/232 (23%) | ||
pbs-6 | NP_498806.1 | PRE1 | 38..246 | CDD:223711 | 50/218 (23%) |
Ntn_hydrolase | 44..258 | CDD:294319 | 51/224 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |