DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and pbs-5

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:156 Identity:40/156 - (25%)
Similarity:69/156 - (44%) Gaps:17/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIP 106
            ||::|.:.|:::....|:....||..:.|.||.::||..:|....|   |::|:     |..:..
 Worm    82 GIIVAVDSRASSGEYISSKSVMKILDIGDRMVATMAGGAADCQFWT---RIVAK-----YCTLYE 138

  Fly   107 CEQLVSHLCDIKQAY---TQYGGK-RPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIG-- 165
            ..:..|........|   |.||.: :...|..:..|:|.| |.|:::.|..|:....|...:|  
 Worm   139 LREKTSITVSAASKYFANTLYGYRGQGLSVGSMVAGYDKK-GPQIFKVDSEGDRCQLKVCSVGSG 202

  Fly   166 --NNFGAAISMLKQELADKENVKLTL 189
              |.:|...:..|.::.|.|..||.|
 Worm   203 SLNAYGILDNHYKPKMTDDEARKLGL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 40/156 (26%)
proteasome_alpha_type_4 3..219 CDD:239721 40/156 (26%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.