DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psma6a

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:234 Identity:76/234 - (32%)
Similarity:130/234 - (55%) Gaps:7/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAG-TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68
            :|...|||||||||||||||.:||:..| |.:.:..:|..::..:.:..:|||||:..:. ::|:
Zfish     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKLLDSSTVTH-LFRI 72

  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133
            .:|:.|.::|:|:|:.......|..|..:::.||..||.:.|...:.||.|.|||....||.|..
Zfish    73 TENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC 137

  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198
            ::.:|.|.:.|.|:|:.||:|.|.|:|||..|.....|.|.|::::  |:.:..|.....:.||.
Zfish   138 MIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKI--KKKLDWTFDQTVETAIS 200

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVE 237
            .||..| .....|.::|:..:...:.|  :.:|.:.:::
Zfish   201 CLSTVL-AIDFKPSELEIGVVTTEEPK--FRILSESEID 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 76/234 (32%)
proteasome_alpha_type_4 3..219 CDD:239721 74/214 (35%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 76/234 (32%)
proteasome_alpha_type_6 8..220 CDD:239723 74/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.