DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and Psmb8

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:250 Identity:63/250 - (25%)
Similarity:105/250 - (42%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITS 81
            |..|:|.|     |..|.|....:.|:::|.:.|:|.....|::...|:..:|..::.:::|..:
Mouse    63 RNVQIEMA-----HGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAA 122

  Fly    82 DA----NVLTSELRLIAQRYQFSYGE---VIPCEQLVSHLCDIKQAYTQYGGKRPFGVSL--LYM 137
            |.    .:|..|.||    |....||   |....:|:|::      ..||.|   .|:|:  :..
Mouse   123 DCQYWERLLAKECRL----YYLRNGERISVSAASKLLSNM------MLQYRG---MGLSMGSMIC 174

  Fly   138 GWDNKYGYQLYQSDPSGN--YGGWKATCIGNN--FGAAISMLKQELADKENVKLTLADAKDLAIK 198
            |||.| |..||..|.:|.  .|...:|..||.  :|...|..:|:|:.:|        |.||..:
Mouse   175 GWDKK-GPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEE--------AYDLGRR 230

  Fly   199 VLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAA 253
            .::........:...|.|..::    :..:..:|..||..|:.||      .|||
Mouse   231 AIAYATHRDNYSGGVVNMYHMK----EDGWVKVESSDVSDLLYKY------GEAA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 60/240 (25%)
proteasome_alpha_type_4 3..219 CDD:239721 54/214 (25%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 58/238 (24%)
proteasome_beta_type_5 73..260 CDD:239730 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.